PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G0375
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 277aa    MW: 32665.7 Da    PI: 7.0178
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G0375genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.61.6e-091344132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     rg W +eEd++l+++v+ +G g+W+t++++ g
      Gh_D07G0375 13 RGLWKPEEDLILKNYVETYGEGNWATVSKRSG 44
                     788*************************9987 PP

2Myb_DNA-binding52.21.4e-1693138148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++eE++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l
      Gh_D07G0375  93 RGGMSKEEEDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 138
                      67789*****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.6E-20690IPR009057Homeodomain-like
PROSITE profilePS500909.268887IPR017877Myb-like domain
SuperFamilySSF466893.37E-2312134IPR009057Homeodomain-like
SMARTSM007173.4E-71289IPR001005SANT/Myb domain
PfamPF002493.1E-91387IPR001005SANT/Myb domain
CDDcd001672.53E-61687No hitNo description
PROSITE profilePS5129425.60688142IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2391141IPR009057Homeodomain-like
SMARTSM007171.8E-1692140IPR001005SANT/Myb domain
PfamPF002496.3E-1593138IPR001005SANT/Myb domain
CDDcd001676.15E-1296138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MENRKEKKSQ SKRGLWKPEE DLILKNYVET YGEGNWATVS KRSGIYIYRY IYRIINYIHI  60
AQMECLYTFS GLMRGGKSCR LRWKNYLRPN IKRGGMSKEE EDLIIRMHKL LGNRWSLIAG  120
RLPGRTDNEV KNYWNTHLNK KSLLGRKRKT IDSNNQHNDN MEDNHIENQD SKKPRQAHDS  180
DHHPIFNTTD GFDLDGNKQE KDDESAAAWM ERVVRFFNYE YDLDYEMVGT PLMMHPDYSN  240
FVFDEEPFTS YTDPFVLFEA FGTADCDVGL GIQSFLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-20131417107B-MYB
1h8a_C8e-201314127127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6238501e-151JX623850.1 Gossypium hirsutum clone NBRI_GE71318 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446931.10.0PREDICTED: transcription factor MYB82-like
TrEMBLA0A0D2N5C00.0A0A0D2N5C0_G
STRINGPOPTR_0018s12780.11e-79(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.19e-65myb domain protein 82